Analytical Data
-
Gene name
CD3G
- Application
-
Alternative Names
CD3G;T3G;T-cell surface glycoProtein CD3 gamma chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09693
-
Expression Region
23-116aa
-
AA Sequence
QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
-
Molecular Weight
18.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD3G, a crucial component of the T-cell receptor (TCR) complex, plays a vital role in T-cell activation and signaling. It encodes the gamma polypeptide of the CD3 complex, which, along with CD3D and CD3E, associates with TCR to facilitate antigen recognition and subsequent T-cell responses. The understanding of CD3G has become increasingly significant in immunology, particularly in the context of cancer therapy, autoimmune diseases, and adoptive T-cell therapies, such as CAR-T cell therapy. The engineering of CD3G recombinant proteins has enabled researchers to explore its functions in T-cell signaling in greater detail and develop novel therapeutic strategies. Investigating CD3G's structure and function can uncover new insights into T-cell development and activation pathways, paving the way for innovative treatments targeting immune responses. Consequently, research on CD3G recombinant proteins aims to optimize T-cell-mediated immunity and address various health challenges, making it a pivotal focus area in modern biomedical research.











