Analytical Data
-
Gene name
AQP4
- Application
-
Alternative Names
AQP4；Aquaporin-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55087
-
Expression Region
253-323aa
-
AA Sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
-
Molecular Weight
24.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of aquaporin-4 (AQP4) recombinant protein has gained significant attention due to its crucial role in water homeostasis in the central nervous system. AQP4 is primarily expressed in astrocytes and is vital for maintaining the integrity of the blood-brain barrier and regulating brain edema. Dysfunctions in AQP4 have been linked to various neurological disorders, including multiple sclerosis, Alzheimer's disease, and neuromyelitis optica. The expression and purification of AQP4 as a recombinant protein allow researchers to explore its structure-function relationship, interaction with other proteins, and its role in cellular water transport mechanisms. Additionally, recombinant AQP4 can be used in drug screening and therapeutic applications, enhancing our understanding of neurodegenerative diseases and potentially leading to novel treatments. The advancements in recombinant protein technology have enabled more efficient production and characterization of AQP4, facilitating extensive studies into its biophysical properties and physiological significance. Thus, AQP4 recombinant protein research not only contributes to fundamental neuroscience but also holds promise for developing targeted therapeutic strategies in neurological disorders.
