Cat: PA1000-9240

Recombinant Human AQP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AQP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AQP2;Aquaporin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P41181

  • Expression Region

    1-271aa

  • AA Sequence

    MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGL GIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAG AALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTD ERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDD HWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEERE VRRRQSVELHSPQSLPRGTKA

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Aquaporin-2 (AQP2) is a water channel protein primarily expressed in the kidney, playing a crucial role in the regulation of water reabsorption in the collecting ducts. Its function is vital for maintaining body fluid homeostasis and urine concentration. Dysfunction or altered expression of AQP2 is associated with various renal and endocrine disorders, such as nephrogenic diabetes insipidus and heart failure. The study of recombinant AQP2 proteins has gained attention as it allows researchers to explore the protein's structure, function, and interaction mechanisms in detail. By expressing AQP2 in heterologous systems, scientists can produce large quantities of the protein, facilitating biochemical assays and structural analyses that highlight how AQP2 operates within cellular membranes. Moreover, investigations into AQP2 variants and their trafficking, regulation by hormones, and pharmacological modulation can pave the way for novel therapeutic strategies. Overall, the focus on AQP2 recombinant proteins is pivotal for understanding kidney physiology and developing treatments for water balance disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US