Analytical Data
-
Gene name
CD3E
- Application
-
Alternative Names
CD3E；T3E；T-cell surface glycoProtein CD3 epsilon chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07766
-
Expression Region
22-126aa
-
AA Sequence
QDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
-
Molecular Weight
40.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD3E, also known as the epsilon chain of the CD3 complex, is a crucial component of the T-cell receptor (TCR) signaling pathway, playing a vital role in T-cell development and activation. The importance of CD3E in the immune response has drawn significant attention in immunology and therapeutic research. It interacts with the TCR complex to initiate T-cell activation upon antigen recognition, thereby facilitating adaptive immunity. Abnormalities in CD3E expression or function can lead to immune deficiencies or autoimmune diseases, making it a potential target for immunotherapy. Recent studies have focused on the development of CD3E recombinant proteins, which can be used to enhance T-cell responses in various therapeutic contexts, including cancer treatment and infectious diseases. These recombinant proteins hold promise for use in engineered T-cell therapies, such as CAR-T cells, where they can enhance the efficacy of T-cells against tumors. As the understanding of CD3E and its signaling pathways evolves, the potential applications in immune modulation and personalized medicine continue to expand, positioning CD3E as a significant focus area in immunological research and therapeutic innovation.
