Cat: PA1000-474DB

Recombinant Human CCNG1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCNG1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCNG1;CCNG;CYCG1;Cyclin-G1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51959

  • Expression Region

    1-295aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNALLEQESRCQPK VCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLL DRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFT VSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKH SKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS YYRITHLPTIPEMVP

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCNG1, or Cyclin G1, is a member of the cyclin family, known for its role in regulating cell cycle progression and cellular responses to stress. Recent studies have highlighted its significance in various biological processes, particularly in cancer research, where it may act as a tumor suppressor. Dysregulation of CCNG1 has been implicated in the progression of several malignancies, making it a potential biomarker for cancer diagnosis and prognosis. Additionally, CCNG1 is involved in the modulation of apoptosis and DNA damage response, further underscoring its importance in maintaining genomic stability. Given these functions, researchers have focused on the expression and characterization of recombinant CCNG1 protein to better understand its biological activities and therapeutic potential. By producing this protein in a controlled environment, scientists aim to investigate its interactions with other cellular molecules, elucidate its precise role in cell cycle regulation, and explore its potential as a target for cancer therapies. The study of CCNG1, particularly in its recombinant form, can provide valuable insights into its mechanisms of action and its contributions to malignancies, paving the way for novel approaches in cancer treatment and management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US