Cat: PA1000-464DB

Recombinant Human CCL3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCL3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCL3;G0S19-1;MIP1A;SCYA3;C-C motif chemokine 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10147

  • Expression Region

    24-92aa

  • AA Sequence

    SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

  • Molecular Weight

    14.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCL3, also known as macrophage inflammatory protein-1 alpha (MIP-1α), is a chemokine primarily involved in the recruitment and activation of immune cells, particularly monocytes and T lymphocytes. It plays a pivotal role in modulating inflammatory responses and has been implicated in various pathological conditions, including autoimmune diseases, cancer progression, and infectious diseases. The ability of CCL3 to influence immune cell trafficking makes it a potential target for therapeutic interventions aimed at regulating immune responses. Research focusing on recombinant CCL3 protein has gained momentum as scientists seek to understand its structure-function relationship, signaling pathways, and interactions with its receptors (CCR1 and CCR5). Understanding these interactions could pave the way for developing novel strategies for disease treatment. Additionally, recombinant CCL3 has been studied for its potential applications in cancer immunotherapy, where enhancing immune responses against tumors is a key objective. Overall, the investigation of CCL3 as a recombinant protein contributes significantly to the fields of immunology and therapeutic development, highlighting its importance in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US