Analytical Data
-
Gene name
CCL3
- Application
-
Alternative Names
CCL3；G0S19-1；MIP1A；SCYA3；C-C motif chemokine 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10147
-
Expression Region
24-92aa
-
AA Sequence
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
-
Molecular Weight
14.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL3, also known as macrophage inflammatory protein-1 alpha (MIP-1α), is a chemokine primarily involved in the recruitment and activation of immune cells, particularly monocytes and T lymphocytes. It plays a pivotal role in modulating inflammatory responses and has been implicated in various pathological conditions, including autoimmune diseases, cancer progression, and infectious diseases. The ability of CCL3 to influence immune cell trafficking makes it a potential target for therapeutic interventions aimed at regulating immune responses. Research focusing on recombinant CCL3 protein has gained momentum as scientists seek to understand its structure-function relationship, signaling pathways, and interactions with its receptors (CCR1 and CCR5). Understanding these interactions could pave the way for developing novel strategies for disease treatment. Additionally, recombinant CCL3 has been studied for its potential applications in cancer immunotherapy, where enhancing immune responses against tumors is a key objective. Overall, the investigation of CCL3 as a recombinant protein contributes significantly to the fields of immunology and therapeutic development, highlighting its importance in health and disease.
