Analytical Data
-
Gene name
CCL27
- Application
-
Alternative Names
CCL27;ILC;SCYA27;C-C motif chemokine 27
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y4X3
-
Expression Region
25-112aa
-
AA Sequence
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQR SICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
-
Molecular Weight
10 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL27, also known as cutaneous T cell-attracting chemokine, is a pivotal cytokine involved in skin immune responses and inflammatory skin diseases. Its primary function is to attract and activate T cells, particularly in the skin, making it crucial for both innate and adaptive immunity. The study of CCL27 is particularly significant in the context of dermatological disorders such as psoriasis, atopic dermatitis, and allergic contact dermatitis, where its expression is often dysregulated. Researchers have focused on the recombinant production of CCL27 protein to explore its biological effects and signaling pathways more thoroughly. The ability to generate recombinant CCL27 allows investigators to conduct in vitro and in vivo experiments, elucidating its role in T cell migration and skin inflammation. Additionally, understanding CCL27’s interactions with its receptor, CCR10, provides insights into potential therapeutic targets for managing skin diseases. In recent years, there has been growing interest in the role of CCL27 in cancer biology, particularly in skin cancers, further broadening its research implications. Overall, the exploration of recombinant CCL27 not only advances our fundamental understanding of skin immunology but also opens new avenues for the development of targeted treatments for skin-related conditions.











