Cat: PA1000-462DB

Recombinant Human CCL27 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCL27

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCL27;ILC;SCYA27;C-C motif chemokine 27

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y4X3

  • Expression Region

    25-112aa

  • AA Sequence

    FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQR SICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

  • Molecular Weight

    10 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCL27, also known as cutaneous T cell-attracting chemokine, is a pivotal cytokine involved in skin immune responses and inflammatory skin diseases. Its primary function is to attract and activate T cells, particularly in the skin, making it crucial for both innate and adaptive immunity. The study of CCL27 is particularly significant in the context of dermatological disorders such as psoriasis, atopic dermatitis, and allergic contact dermatitis, where its expression is often dysregulated. Researchers have focused on the recombinant production of CCL27 protein to explore its biological effects and signaling pathways more thoroughly. The ability to generate recombinant CCL27 allows investigators to conduct in vitro and in vivo experiments, elucidating its role in T cell migration and skin inflammation. Additionally, understanding CCL27’s interactions with its receptor, CCR10, provides insights into potential therapeutic targets for managing skin diseases. In recent years, there has been growing interest in the role of CCL27 in cancer biology, particularly in skin cancers, further broadening its research implications. Overall, the exploration of recombinant CCL27 not only advances our fundamental understanding of skin immunology but also opens new avenues for the development of targeted treatments for skin-related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US