Cat: PA1000-441DB

Recombinant Human CCBL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCBL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCBL1;CCBL1;Kynurenine--oxoglutarate transaminase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16773

  • Expression Region

    1-442aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAKQLQARRLDGIDYNPWVEFVKLASE HDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILA SFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDC YEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKA LVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHI SIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSV FHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSV GLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLV AIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCBL1 (Collagen and Calcium Binding EGF Domains 1) is a protein that plays a crucial role in various biological processes, including cell adhesion, migration, and tissue remodeling. Research suggests that CCBL1 is involved in the regulation of extracellular matrix components and can influence the behavior of cells in the tumor microenvironment, thereby impacting cancer progression and metastasis. Investigating the recombinant CCBL1 protein has gained attention due to its potential applications in both therapeutic and diagnostic contexts. The recombinant form allows for detailed studies of its structure and function, as well as its interactions with other proteins and cellular components. Moreover, understanding the mechanisms by which CCBL1 influences cellular behavior may provide insights into novel therapeutic strategies for cancer and other diseases characterized by aberrant cell signaling and matrix remodeling. This research underscores the importance of CCBL1 in the context of cellular dynamics, and it opens opportunities for developing targeted treatments that could mitigate the effects of pathological conditions associated with its dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US