Cat: PA1000-9193

Recombinant Human CTBP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CTBP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CTBP2;C-terminal-binding Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56545

  • Expression Region

    1-445aa

  • AA Sequence

    MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPI LKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRV IVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNT WLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAK AFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNH HLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLP AAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ

  • Molecular Weight

    75 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CTBP2 (C-Terminal Binding Protein 2) is a crucial transcriptional co-regulator involved in various cellular processes, including development, cell differentiation, and apoptosis. Its role in oncogenesis and the regulation of genes associated with cell cycle progression has garnered significant attention in cancer research. Abnormal expression of CTBP2 has been implicated in several malignancies, suggesting potential links between its function and tumorigenesis. The protein's ability to interact with a wide array of transcription factors and its involvement in the modulation of signaling pathways underscore the importance of understanding its mechanisms of action. Additionally, CTBP2 exhibits a dynamic interplay with the cellular environment, influencing gene expression in response to various extracellular signals. Research on the recombinant protein CTBP2 has aimed to elucidate its structural properties and protein-protein interactions, providing insights into its biological functions. By generating and characterizing recombinant CTBP2, researchers hope to deepen their understanding of its role in health and disease, potentially identifying novel therapeutic targets for cancer treatment and other pathologies associated with its dysregulation. The investigation into CTBP2 not only enhances our knowledge of gene regulation but also lays the groundwork for future studies exploring its therapeutic potentials and implications in cellular signaling networks.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US