Cat: PA1000-438DB

Recombinant Human CBR4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CBR4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CBR4;SDR45C1;3-oxoacyl-[acyl-carrier-Protein] reductase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N4T8

  • Expression Region

    1-237aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMDKVCAVFGGSRGIGRAVAQLMARKGYRLA VIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEMEKHLGRVNFL VNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSI VNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGF VHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVD GGLQLIL

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CBR4 (Cinnamate-Binding Protein 4) is an enzyme that plays a crucial role in the phenylpropanoid pathway, which is vital for plant growth, development, and defense mechanisms. Recent studies have indicated that CBR4 is involved in the reduction of cinnamic acid derivatives, contributing to the biosynthesis of important secondary metabolites such as flavonoids, lignins, and other phenolic compounds. These metabolites are not only essential for plant robustness but also have significant applications in pharmaceuticals and agriculture due to their antioxidant, anti-inflammatory, and antimicrobial properties. The recombinant production of CBR4 protein is essential for studying its enzymatic activity, substrate specificity, and regulatory mechanisms. By expressing CBR4 in a heterologous system, researchers aim to gain insights into its structure-function relationships, which can facilitate the engineering of biosynthetic pathways in plants for enhanced metabolite production. Furthermore, understanding the functional dynamics of CBR4 can lead to the development of innovative strategies for crop improvement, resilience against biotic and abiotic stressors, and the sustainable production of valuable phytochemicals. Thus, investigating CBR4 through recombinant protein technology not only enriches our knowledge of plant biochemistry but also opens new avenues for biotechnological applications in sustainable agriculture and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US