Analytical Data
-
Gene name
CASP2
- Application
-
Alternative Names
CASP2；ICH1；NEDD2；Caspase-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42575
-
Expression Region
2-452aa
-
AA Sequence
AAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
-
Molecular Weight
66.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Caspase-2 (CASP2) is an initiator caspase that plays a crucial role in programmed cell death, cellular stress response, and maintaining cellular homeostasis. It has garnered attention in recent years due to its dual role in apoptosis and inflammation, making it a significant target for studying various diseases, including cancer and neurodegenerative disorders. Unlike other caspases, CASP2 is somewhat enigmatic as its activation mechanisms and physiological functions remain less understood. Research has shown that CASP2 can be activated by diverse stimuli, including DNA damage and oxidative stress, leading to apoptotic or non-apoptotic outcomes depending on the cellular context. The generation of recombinant CASP2 proteins has enabled researchers to dissect its activation pathways and substrate specificity in vitro, facilitating a deeper understanding of its functional roles in cellular processes. Moreover, studying CASP2 through recombinant technology allows for the exploration of its domains and interaction partners, potentially revealing novel therapeutic targets. Given the growing insight into the involvement of CASP2 in various pathological conditions, the development of CASP2 inhibitors or modulators could pave the way for innovative treatments. Overall, research on recombinant CASP2 proteins is pivotal for elucidating the intricate networks governing apoptosis and inflammatory responses, thus contributing to the understanding of disease mechanisms and the discovery of new therapeutic strategies.
