Analytical Data
-
Gene name
TACR2
- Application
-
Alternative Names
TACR2；NK2R；NKNAR；TAC2R；Substance-K receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21452
-
Expression Region
1-398aa
-
AA Sequence
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
-
Molecular Weight
44.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TACR2, or Tachykinin Receptor 2, is a member of the neurokinin receptor family, which primarily binds to neurokinin B. This receptor plays a crucial role in various physiological processes, including pain transmission, neurogenic inflammation, and the regulation of the reproductive system. Recent studies have indicated its involvement in neurological disorders and mood regulation, making it a potential target for therapeutic interventions. The need for TACR2 recombinant protein arises from the necessity to better understand its structural characteristics and functional mechanisms. By producing TACR2 in a recombinant form, researchers can facilitate more detailed biochemical assays, structural studies, and drug screening processes. The availability of this protein is essential for elucidating its signaling pathways and interactions with various ligands, which could pave the way for developing novel pharmacological agents aimed at modulating its activity. Moreover, TACR2 serves as a valuable model for studying G-protein coupled receptors (GPCRs) and their roles in various disease states, further emphasizing the importance of this research. Overall, the exploration of TACR2 through recombinant protein technology holds significant promise in advancing our knowledge of its biological functions and therapeutic potential.
