Analytical Data
-
Gene name
PRH2
- Application
-
Alternative Names
PRH2;PRH2;Salivary acidic proline-rich phosphoProtein 1/2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02810
-
Expression Region
1-166aa
-
AA Sequence
MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRH2, or Phosphatase Regulator of HSPC300, is a novel protein that has gained attention in recent years due to its significant role in various biological processes, including cell differentiation and development. This protein belongs to the family of regulatory proteins that interact with phosphatases, thereby modulating their activity. The interest in PRH2 stems from its implications in human health, particularly in hematopoiesis and immune response, where it may influence the behavior of hematopoietic stem cells. Research has shown that dysregulation of pathways involving PRH2 can lead to hematological disorders and other diseases, making it a potential therapeutic target. Moreover, understanding the structure-function relationships of PRH2 through recombinant protein studies could provide insights into its mechanisms of action and interactions with other cellular components, paving the way for novel strategies in disease treatment. Current studies involve the expression and purification of PRH2 to elucidate its function and potential as a biomarker or therapeutic target. The ongoing research into PRH2 aims not only to clarify its biological role but also to explore its potential applications in regenerative medicine and cancer therapy, highlighting the importance of this protein in advancing biomedical science.











