Analytical Data
-
Gene name
MGST1
- Application
-
Alternative Names
MGST1；GST12；MGST；Microsomal glutathione S-transferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10620
-
Expression Region
1-155aa
-
AA Sequence
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDC VAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDP STAILHFRLFVGARIYHTIAYLTPLPQPNRALSFFVGYGVTLSMAYRLLK SKLYL
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MGST1 (microsomal glutathione S-transferase 1) is a key enzyme involved in the detoxification of harmful compounds and the metabolism of various xenobiotics in the human body. Its primary function is to catalyze the conjugation of glutathione, a powerful antioxidant, to electrophilic substrates, which facilitates their excretion and reduces oxidative stress. Research on MGST1 has gained significance due to its implications in drug metabolism, cancer biology, and various diseases linked to oxidative stress, such as neurodegenerative disorders and cardiovascular diseases. Moreover, alterations in MGST1 expression have been associated with drug resistance in cancer therapy, highlighting its potential as a therapeutic target. The recombinant production of MGST1 protein enables researchers to investigate its biochemical properties, structural characteristics, and functional mechanisms in detail. By employing techniques such as site-directed mutagenesis and crystal structure analysis, scientists aim to uncover the structure-activity relationship (SAR) of MGST1 and identify potential inhibitors or activators that could modulate its activity. This research holds promise for developing novel pharmacological strategies to enhance detoxification pathways and combat diseases associated with oxidative damage, ultimately contributing to improved health outcomes and targeted therapies in clinical settings.
