Analytical Data
-
Gene name
CRT
- Application
-
Alternative Names
CRT;CRT2;Calreticulin-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27797
-
Expression Region
18-417aa
-
AA Sequence
EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
-
Molecular Weight
50.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ciliary neurotrophic factor (CNTF) is a neurotrophic cytokine that plays a crucial role in the survival and differentiation of neurons. In recent years, recombinant CNTF (CRT) has gained attention for its potential therapeutic applications in neurodegenerative diseases and other neurological disorders. The ability to produce CRT in a controlled manner through recombinant DNA technology has enabled researchers to study its biological activity and mechanisms of action more effectively. As a promising candidate for neuroprotection, CRT's role in promoting neuronal health and supporting the regeneration of damaged tissues has spurred extensive research. Understanding the structure-function relationship of CRT and its signaling pathways may lead to the development of novel treatments for conditions such as amyotrophic lateral sclerosis (ALS) and spinal cord injuries. Furthermore, the production and purification processes of CRT have been refined to enhance yield, stability, and bioactivity, paving the way for clinical applications. Current studies aim to elucidate the optimal dosing strategies, delivery methods, and potential side effects of CRT-based therapies, with the ultimate goal of translating these findings into effective medical interventions. Overall, the research on CRT not only contributes to the basic understanding of neurobiology but also holds promise for innovative approaches to combat debilitating nervous system disorders.











