Analytical Data
-
Gene name
MAP4
- Application
-
Alternative Names
MAP4；Microtubule-associated Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27816
-
Expression Region
939-1152aa
-
AA Sequence
GSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREAQTLDSQIQETSI
-
Molecular Weight
28kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
MAP4 (microtubule-associated protein 4) is a crucial protein involved in stabilizing microtubules and regulating their dynamics, which play a vital role in various cellular processes such as cell division, intracellular transport, and maintaining cell shape. Research indicates that MAP4 is essential for the proper functioning of the cytoskeleton, particularly in neuronal cells where it contributes to axonal growth and development. Given its significance, MAP4 has garnered interest in studies related to neurodegenerative diseases, cancer, and cellular responses to stress. The recombinant expression of MAP4 allows researchers to produce large quantities of this protein for in-depth biochemical and structural analyses, facilitating investigations into its functional mechanisms and interactions with other proteins in the microtubule network. Moreover, the study of MAP4's role in cellular processes can offer insights into potential therapeutic targets for diseases linked to cytoskeletal dysfunction, making it a pivotal subject in molecular and cellular biology research. As scientists continue to explore the intricacies of MAP4’s functions and its impact on cellular health, it holds promise for advancing our understanding of numerous pathologies and developing novel treatment strategies.
