Analytical Data
-
Gene name
C8g
- Application
-
Alternative Names
C8g；Complement component C8 gamma chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07360
-
Expression Region
21-202aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAG TWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQV RQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVK LYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDE VRR
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C8g is a recombinant protein that has garnered significant attention in the field of molecular biology and biotechnology due to its potential applications in various therapeutic and diagnostic areas. The background of C8g research is rooted in the need for novel proteins that can effectively modulate biological processes and provide insights into disease mechanisms. Initially derived from viral or bacterial sources, C8g has been engineered to enhance its stability, specificity, and efficacy. Researchers are particularly interested in its ability to interact with specific cellular pathways, making it a candidate for targeted therapies in diseases such as cancer and autoimmune disorders. The advent of advanced gene editing technologies and expression systems has facilitated the production of C8g, allowing for large-scale synthesis and subsequent functional studies. Furthermore, studies have indicated that C8g may play a crucial role in immune response regulation, which opens avenues for vaccine development and immunotherapy. Current research is focused on elucidating the structure-function relationship of C8g, optimizing its pharmacokinetics, and exploring its potential in combination therapies. As the understanding of C8g expands, its applications in personalized medicine and innovative treatment strategies continue to emerge, highlighting the ongoing relevance of recombinant proteins in modern biomedicine.
