Analytical Data
-
Gene name
C1QBP
- Application
-
Alternative Names
C1QBP;GC1QBP;HABP1;SF2P32;Complement component 1 Q subcomponent-binding Protein. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07021
-
Expression Region
1-282aa
-
AA Sequence
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1QBP, also known as complement component 1 q subcomponent binding protein, is a multifunctional protein that plays crucial roles in various biological processes, including innate immunity, apoptosis, and cellular signaling. It primarily acts as a receptor for complement component C1q, thereby playing a significant role in the complement system, which is essential for immune defense and pathogen clearance. Recent studies have highlighted C1QBP's involvement in several pathological conditions, including autoimmune diseases, viral infections, and cancer, prompting researchers to explore its potential as a therapeutic target. Understanding the structure and function of C1QBP is essential for developing novel strategies in disease intervention. Recombinant C1QBP proteins have been produced for further investigation into their biological roles and mechanisms of action. The ability to manipulate and study this protein in vitro offers significant insights into how it interacts with other immune components. Furthermore, C1QBP's emerging role in modulating cellular responses and its interactions with receptors and signaling pathways suggest it may serve as a crucial mediator in health and disease. As research progresses, the therapeutic implications of C1QBP in enhancing immune responses or as a biomarker for disease prognosis are increasingly recognized, making it a vital focus in immunological and biochemical studies.











