Cat: PA1000-383DB

Recombinant Human C1GALT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C1GALT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C1GALT1;COSMC;C1GALT1-specific chaperone 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NS00

  • Expression Region

    30-363aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSLLGEKVDTQPNVLHNDPHARHSDDNGQ NHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKH VKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHE HYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGY MSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGD SRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAV SFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDT KVKLGNP

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C1GALT1, or Core 1 β1,3-galactosyltransferase 1, is a key enzyme involved in the biosynthesis of the O-glycan structures on glycoproteins, specifically responsible for the addition of galactose to the core 1 structure. This modification plays a critical role in various biological processes, including cell-cell recognition, signaling, and immune responses. Abnormal expression of C1GALT1 has been associated with several diseases, including cancer, where it affects tumor progression and metastasis by altering glycosylation patterns. Given its significant role in glycan synthesis and disease progression, recombinant C1GALT1 protein has become an important subject of research. By studying this enzyme, researchers aim to uncover its mechanisms of action and assess its potential as a therapeutic target. The production of recombinant C1GALT1 allows for detailed analyses, including enzymatic activity assays, structural studies, and the development of inhibitors to modulate its function. The insights gained from this research could lead to novel approaches in treating diseases related to aberrant glycosylation, further highlighting the importance of C1GALT1 in glycomics and molecular biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US