Analytical Data
-
Gene name
EOMES
- Application
-
Alternative Names
EOMES；TBR2；Eomesodermin homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95936
-
Expression Region
547-645aa
-
AA Sequence
PYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTS PTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EOMES (eomesodermin) is a T-box transcription factor that plays a critical role in the development and differentiation of various cell types, particularly in the immune system and during embryogenesis. Its pivotal function in T cell development has garnered significant interest in immunology and developmental biology. EOMES is necessary for the development of CD8+ T cells and is also involved in the differentiation of natural killer (NK) cells, highlighting its importance in adaptive and innate immunity. Additionally, EOMES is expressed during the early stages of embryonic development and has been implicated in the regulation of mesoderm formation and early neuronal development. Research on EOMES recombinant proteins has focused on understanding its structural characteristics, gene regulation mechanisms, and interactions with other transcription factors, which provide valuable insights into its functional roles. The recombinant EOMES protein serves as an essential tool for investigating the signaling pathways and molecular interactions that govern T cell differentiation and function. Moreover, studying EOMES can help elucidate the mechanisms underlying various diseases, including cancers and autoimmune disorders, where its regulatory functions may be disrupted. Overall, the study of EOMES recombinant proteins not only advances our understanding of cellular differentiation processes but also opens potential therapeutic avenues for modulating immune responses in disease settings.
