Analytical Data
-
Gene name
MTNR1A
- Application
-
Alternative Names
MTNR1A；Melatonin receptor type 1A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48039
-
Expression Region
296-350aa
-
AA Sequence
GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV KVDSV
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTNR1A, the melatonin receptor type 1A, plays a critical role in regulating various physiological processes through its interaction with melatonin, a hormone primarily involved in the regulation of circadian rhythms and sleep-wake cycles. Research on MTNR1A has gained momentum due to its implications in sleep disorders, mood regulation, and reproductive functions. As a G protein-coupled receptor (GPCR), MTNR1A activates intracellular signaling pathways when bound by melatonin, influencing neuronal activity and various metabolic processes. The exploration of MTNR1A and its recombinant protein has become increasingly important in pharmacology and therapeutic applications, particularly in the context of developing new treatments for insomnia, depression, and anxiety disorders. Additionally, the understanding of MTNR1A's structure and function can facilitate the design of selective ligands that may enhance or inhibit its activity, offering potential advances in personalized medicine. The production of recombinant MTNR1A protein allows for detailed biochemical studies, contributing to our understanding of receptor dynamics, ligand binding, and signaling mechanisms. Overall, the research on MTNR1A recombinant proteins holds promise not only for elucidating the complex biology of melatonin signaling but also for the development of innovative therapeutic strategies targeting related health issues.
