Analytical Data
-
Gene name
DNASE1L2
- Application
-
Alternative Names
DNASE1L2；DHP1；DNAS1L2；Deoxyribonuclease-1-like 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92874
-
Expression Region
21-299aa
-
AA Sequence
ALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR
-
Molecular Weight
38.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNASE1L2 (Deoxyribonuclease I-like 2) is an important enzyme involved in the degradation of extracellular DNA, playing a crucial role in maintaining cellular homeostasis and immune response. Mutations in the DNASE1L2 gene have been linked to various autoimmune diseases, particularly systemic lupus erythematosus (SLE), highlighting its potential role in the pathogenesis of these conditions. The enzyme is known for its ability to process and eliminate free DNAs from the extracellular environment, which is essential for preventing autoimmune reactions triggered by the accumulation of self-DNA in tissues. Research into recombinant DNASE1L2 proteins has gained momentum, aiming to understand their structural and functional properties, as well as their therapeutic potential. By producing recombinant variants of DNASE1L2, scientists are exploring the enzyme's mechanisms and its interaction with immune cells, which could pave the way for novel treatments for autoimmune disorders and other related diseases. In addition, the optimization of recombinant DNASE1L2 expression systems may allow for large-scale production of this protein, facilitating further studies into its physiological roles and therapeutic applications. Overall, the investigation into DNASE1L2 and its recombinant forms is a significant area of research, promising advancements in our understanding of immune regulation and potential interventions for autoimmune diseases.
