Cat: PA1000-375DB

Recombinant Human BTF3L4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BTF3L4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BTF3L4;Transcription factor BTF3 homolog 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96K17

  • Expression Region

    1-78aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMNQEKLAKLQAQVRIGGKGTARRKKKV VHRTATADDKKLQSSLKKLAVNNIAGIEESWTVKHQNQKTLMRKMMMFQI L

  • Molecular Weight

    11 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BTF3L4 (Basic Transcription Factor 3 Like 4) is a transcription factor belonging to the BTF3 family that plays a crucial role in the regulation of gene expression, particularly in the context of cell growth and differentiation. Research into BTF3L4 has gained momentum due to its involvement in various cellular processes and its potential implications in disease mechanisms, including cancer. Studies have demonstrated that BTF3L4 can influence the transcriptional activity of numerous genes by interacting with other transcription factors and chromatin remodeling complexes. Moreover, aberrant expression of BTF3L4 has been associated with tumor progression in several cancer types, suggesting that it may serve as a biomarker or therapeutic target. Consequently, the recombinant production of BTF3L4 protein is of significant interest for functional characterization, structural studies, and high-throughput screening applications. By understanding its molecular functions and interactions, researchers hope to elucidate the underlying mechanisms of its role in cellular processes and identify potential therapeutic strategies for diseases linked to its dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US