Analytical Data
-
Gene name
BTF3L4
- Application
-
Alternative Names
BTF3L4；Transcription factor BTF3 homolog 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96K17
-
Expression Region
1-78aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMNQEKLAKLQAQVRIGGKGTARRKKKV VHRTATADDKKLQSSLKKLAVNNIAGIEESWTVKHQNQKTLMRKMMMFQI L
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTF3L4 (Basic Transcription Factor 3 Like 4) is a transcription factor belonging to the BTF3 family that plays a crucial role in the regulation of gene expression, particularly in the context of cell growth and differentiation. Research into BTF3L4 has gained momentum due to its involvement in various cellular processes and its potential implications in disease mechanisms, including cancer. Studies have demonstrated that BTF3L4 can influence the transcriptional activity of numerous genes by interacting with other transcription factors and chromatin remodeling complexes. Moreover, aberrant expression of BTF3L4 has been associated with tumor progression in several cancer types, suggesting that it may serve as a biomarker or therapeutic target. Consequently, the recombinant production of BTF3L4 protein is of significant interest for functional characterization, structural studies, and high-throughput screening applications. By understanding its molecular functions and interactions, researchers hope to elucidate the underlying mechanisms of its role in cellular processes and identify potential therapeutic strategies for diseases linked to its dysregulation.
