Cat: PA1000-9142

Recombinant Human SYP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SYP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SYP;Synaptophysin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08247

  • Expression Region

    1-313aa

  • AA Sequence

    MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYS GELQLNVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVG DYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAV FAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVT SGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGD AYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQ GYGPQGAPTSFSNQM

  • Molecular Weight

    61 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

In recent years, the study of SYP (Synaptophysin) recombinant proteins has gained significant attention due to their crucial role in synaptic function and neurobiology. SYP is a synaptic vesicle protein that is predominantly found in the presynaptic terminals of neurons, where it plays an essential role in neurotransmitter release and synaptic plasticity. Abnormalities in SYP expression have been implicated in various neurological disorders, including schizophrenia, Alzheimer's disease, and other neurodegenerative conditions. The recombinant production of SYP proteins allows researchers to investigate their structural and functional properties in detail, providing insights into their mechanisms of action within synaptic transmission. Furthermore, these studies facilitate the development of potential therapeutic strategies to target synaptic dysfunction in neurological disorders. By utilizing advanced techniques such as molecular cloning and protein expression systems, scientists are now able to produce large quantities of functional SYP protein for biochemical assays, structural analyses, and potential drug development. The ongoing research into SYP recombinant proteins is essential for expanding our understanding of neuronal communication and the molecular underpinnings of synaptic diseases, ultimately contributing to the advancement of targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US