Analytical Data
-
Gene name
COPT1
- Application
-
Alternative Names
COPT1;COPT1;CTR1;High affinity copper uptake Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15431
-
Expression Region
1-190aa
-
AA Sequence
MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFG FKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVS IRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLM LIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COPT1 (Copper Transporter 1) is a transmembrane protein that plays a crucial role in the homeostasis of copper, an essential trace element necessary for various biological processes. Aberrations in copper transport can lead to disorders such as Menkes disease and Wilson's disease, which are characterized by copper deficiency and accumulation, respectively. The study of COPT1 recombinant proteins has gained prominence due to their potential therapeutic applications and the need to understand copper metabolism at a molecular level. Functionally, COPT1 mediates the uptake of cupric ions across cellular membranes, making it vital for cellular processes such as mitochondrial function, antioxidant defense, and enzyme activity, where copper acts as a cofactor. Recent research efforts have focused on elucidating the structural and functional characteristics of COPT1 through recombinant techniques, facilitating insights into its transport mechanisms and regulation. By producing and characterizing COPT1 as a recombinant protein, scientists aim to explore its interaction with ligands and other proteins, paving the way for the development of targeted therapies for various copper-related disorders. Additionally, the generation of recombinant COPT1 can serve as a valuable tool for high-throughput screening of small molecule modulators, which could lead to advancements in drug development. Overall, the study of COPT1, particularly through the lens of recombinant protein research, holds significant implications for both our understanding of metal ion homeostasis and the development of clinical interventions for copper metabolism disorders.











