Analytical Data
-
Gene name
SOD4
- Application
-
Alternative Names
SOD4；PGA2；SOD32；Cell surface superoxide dismutase [Cu-Zn] 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14618
-
Expression Region
1-274aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVR KSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGS GQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLH VHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAI FRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGII ARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SOD4, or superoxide dismutase 4, is a vital enzyme that plays a crucial role in protecting cells from oxidative stress by catalyzing the dismutation of superoxide radicals into oxygen and hydrogen peroxide. This enzyme is particularly important in various biological processes, including inflammation, aging, and neurodegenerative diseases, as excessive oxidative stress is linked to the pathology of conditions such as Alzheimer's and Parkinson's diseases. Research on SOD4 recombinant proteins has gained momentum due to their potential therapeutic applications in mitigating oxidative damage. By producing SOD4 through recombinant DNA technology, researchers can achieve high yields and ensure the protein's purity, facilitating detailed studies on its structure-function relationships and its protective mechanisms in biological systems. The investigation of SOD4's enzymatic activity, stability, and interaction with cellular components is pivotal for developing targeted drugs and therapeutic approaches. Furthermore, understanding the regulation of SOD4 expression and its role in cellular signaling pathways could illuminate new strategies for combating oxidative stress-related disorders. As the field of oxidative stress research expands, SOD4 recombinant proteins stand out as promising candidates for novel therapeutic interventions, underscoring the importance of continued research in this area.
