Analytical Data
-
Gene name
BOLA3
- Application
-
Alternative Names
BOLA3;BolA-like Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53S33
-
Expression Region
1-107aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAAWSPAAAAPLLRGIRGLPLHHRMFA TQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRT VQQHQMVNQALKEEIKEMHGLRIFTSVPKR
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BOLA3, a member of the BOLA family of proteins, has emerged as a significant focus in the field of molecular biology and biochemistry due to its involvement in essential cellular processes. Initially identified in the context of human health and disease, BOLA3 has been implicated in the metabolism of essential metals and oxidative stress response, making it crucial for cellular homeostasis. Its role as a potential chaperone for iron and other transition metals highlights its importance in biological systems where metal regulation is vital, such as in erythropoiesis and mitochondrial function. Additionally, research has suggested that mutations or dysregulation of BOLA3 may be linked to various pathological conditions, including developmental disorders and metabolic syndromes. The protein's structure and interaction with other cellular components are subject to ongoing investigation, as understanding these mechanisms could reveal insights into the broader implications of metal ion homeostasis in health and disease. With advancements in recombinant protein technology, researchers have been able to produce BOLA3 for detailed functional studies, thereby facilitating the exploration of its biochemical properties and therapeutic potential. Overall, the study of BOLA3 is poised to contribute significantly to our understanding of metal biology and its implications in human health.











