Cat: PA1000-359DB

Recombinant Human BOLA3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BOLA3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BOLA3;BolA-like Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q53S33

  • Expression Region

    1-107aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAAWSPAAAAPLLRGIRGLPLHHRMFA TQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRT VQQHQMVNQALKEEIKEMHGLRIFTSVPKR

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BOLA3, a member of the BOLA family of proteins, has emerged as a significant focus in the field of molecular biology and biochemistry due to its involvement in essential cellular processes. Initially identified in the context of human health and disease, BOLA3 has been implicated in the metabolism of essential metals and oxidative stress response, making it crucial for cellular homeostasis. Its role as a potential chaperone for iron and other transition metals highlights its importance in biological systems where metal regulation is vital, such as in erythropoiesis and mitochondrial function. Additionally, research has suggested that mutations or dysregulation of BOLA3 may be linked to various pathological conditions, including developmental disorders and metabolic syndromes. The protein's structure and interaction with other cellular components are subject to ongoing investigation, as understanding these mechanisms could reveal insights into the broader implications of metal ion homeostasis in health and disease. With advancements in recombinant protein technology, researchers have been able to produce BOLA3 for detailed functional studies, thereby facilitating the exploration of its biochemical properties and therapeutic potential. Overall, the study of BOLA3 is poised to contribute significantly to our understanding of metal biology and its implications in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US