Analytical Data
-
Gene name
BMPR1A
- Application
-
Alternative Names
BMPR1A；BMP2A；Bone morphogenetic Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36894
-
Expression Region
177-532aa
-
AA Sequence
KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
-
Molecular Weight
56.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Bone morphogenetic protein receptor 1A (BMPR1A) is a member of the transforming growth factor-beta (TGF-β) superfamily and plays a critical role in various biological processes, including embryonic development, bone formation, and tissue homeostasis. Defects in BMPR1A signaling are associated with several pathologies, including pulmonary arterial hypertension and hereditary nonpolyposis colorectal cancer, making it a significant target for therapeutic research. The receptor functions primarily as a transducer of BMP signals, mediating downstream effects that influence cellular differentiation, proliferation, and apoptosis. Studies have shown that BMPR1A can modulate multiple signaling pathways, including the SMAD and non-SMAD pathways, underlining its complex role in cellular communication. The development and characterization of recombinant BMPR1A proteins offer valuable tools for elucidating the receptor's structure-function relationships and its interactions with various ligands in vitro and in vivo. This research is crucial for understanding the receptor's potential as a therapeutic target and for designing innovative strategies to manipulate BMP signaling for clinical applications. Advances in recombinant protein techniques have facilitated the production of biologically active BMPR1A, enabling researchers to explore its signaling mechanisms and contribute to the discovery of novel treatments for diseases linked to abnormal BMP signaling.
