Analytical Data
-
Gene name
BMPR1B
- Application
-
Alternative Names
BMPR1B；Bone morphogenetic Protein receptor type-1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00238
-
Expression Region
149-502aa
-
AA Sequence
RYKRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL
-
Molecular Weight
68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BMPR1B (Bone Morphogenetic Protein Receptor Type 1B) is a member of the bone morphogenetic protein (BMP) receptor family, which plays a crucial role in various physiological processes, including bone development, embryogenesis, and tissue homeostasis. The receptor is activated by BMP ligands, leading to a cascade of intracellular signaling events that influence cellular proliferation, differentiation, and apoptosis. Research has increasingly focused on BMPR1B due to its potential implications in developmental biology, regenerative medicine, and cancer. Studies have shown that mutations or dysregulation of BMPR1B can contribute to congenital disorders and malignancies, highlighting its importance as a therapeutic target. Moreover, the generation of recombinant BMPR1B protein facilitates investigations into its structural and functional properties, enabling a deeper understanding of its signaling mechanisms. These insights could pave the way for novel therapies aimed at manipulating BMP signaling pathways in various diseases. As interest in BMPR1B continues to grow, its study could provide vital contributions to both fundamental biology and clinical applications.
