Cat: PA1000-353DB

Recombinant Human BMP8B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BMP8B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BMP8B;BMP8;Bone morphogenetic Protein 8B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P34820

  • Expression Region

    274-362aa

  • AA Sequence

    KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQ GYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV

  • Molecular Weight

    35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BMP8B (Bone Morphogenetic Protein 8B) is a member of the BMP family, which plays a critical role in various biological processes, including bone formation, tissue regeneration, and cellular differentiation. It is particularly significant in the context of reproductive biology and metabolism, where it has been implicated in neural regulation and energy homeostasis. Research indicates that BMP8B is involved in the development and function of brown adipose tissue and may influence metabolic pathways through its role in regulating thermogenesis and energy expenditure. Given its multifaceted roles, recombinant BMP8B protein has gained attention for its potential therapeutic applications in obesity, diabetes, and other metabolic disorders. Understanding its structure, function, and signaling pathways is crucial for elucidating its biological effects and developing targeted therapies. As scientists seek to leverage the benefits of BMP8B in clinical settings, studies on its recombinant form help unravel its mechanisms of action, paving the way for innovative strategies in metabolic disease management and regenerative medicine. This growing interest in BMP8B necessitates comprehensive research to optimize its production, stability, and bioactivity for future applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US