Analytical Data
-
Gene name
BMP8B
- Application
-
Alternative Names
BMP8B；BMP8；Bone morphogenetic Protein 8B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34820
-
Expression Region
274-362aa
-
AA Sequence
KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQ GYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BMP8B (Bone Morphogenetic Protein 8B) is a member of the BMP family, which plays a critical role in various biological processes, including bone formation, tissue regeneration, and cellular differentiation. It is particularly significant in the context of reproductive biology and metabolism, where it has been implicated in neural regulation and energy homeostasis. Research indicates that BMP8B is involved in the development and function of brown adipose tissue and may influence metabolic pathways through its role in regulating thermogenesis and energy expenditure. Given its multifaceted roles, recombinant BMP8B protein has gained attention for its potential therapeutic applications in obesity, diabetes, and other metabolic disorders. Understanding its structure, function, and signaling pathways is crucial for elucidating its biological effects and developing targeted therapies. As scientists seek to leverage the benefits of BMP8B in clinical settings, studies on its recombinant form help unravel its mechanisms of action, paving the way for innovative strategies in metabolic disease management and regenerative medicine. This growing interest in BMP8B necessitates comprehensive research to optimize its production, stability, and bioactivity for future applications.
