Cat: PA1000-9118

Recombinant Human AGA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AGA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AGA;N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20933

  • Expression Region

    24-346aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSSSPLPLVVNTWPFKNATEAAWRALASG GSALDAVESGCAMCEREQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVG AVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFAQSMGFINEDLSTTA SQALHSDWLARNCQPNYWRNVIPDPSKYCGPYKPPGILKQDIPIHKETED DRGHDTIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDT AGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEF FGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AGA (Adenylate Glycolytic Enzyme) recombinant protein research has gained significant interest due to its potential applications in biotechnology and medicine. AGA plays a crucial role in purine metabolism, and its dysfunction is associated with various metabolic disorders, highlighting its importance in understanding and treating such conditions. The ability to produce AGA in recombinant form allows for in-depth studies on its structure and function, enabling researchers to elucidate its biochemical pathways and interactions within cellular systems. The development of AGA recombinant proteins also paves the way for innovative therapeutic approaches, including enzyme replacement therapies for patients with enzymatic deficiencies. Furthermore, the generation of large quantities of pure AGA can facilitate drug discovery processes, as these proteins serve as vital tools in high-throughput screening and assay development. The advancement of techniques like CRISPR and synthetic biology also enhances the capacity for engineering AGA to improve its efficacy or to create novel variants with tailored properties, further expanding its utility in various scientific domains. Overall, AGA recombinant protein research not only contributes to our fundamental understanding of metabolic processes but also holds promise for developing targeted treatments for metabolic disorders, making it a vital area of interest in contemporary biological research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US