Cat: PA1000-339DB

Recombinant Human BIN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BIN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BIN1;AMPHL;Myc box-dependent-interacting Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00499-7

  • Expression Region

    1-439aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAEMGSKGVTAGKIASNVQKKLTRAQEKVL QKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASK KLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYL GQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIK AQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQ NLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIR VNHEPEPAGGATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETAASE AASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTAT DTDELQLRAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVF PENFTERVP

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BIN1 (Bridging Integrator 1), also known as Amphiphysin 2, is a protein that plays crucial roles in various cellular processes, including endocytosis, membrane dynamics, and cytoskeletal organization. Its involvement in these processes has sparked significant interest in the scientific community, particularly due to its association with neurodegenerative diseases and cancer. Research has shown that BIN1 interacts with several key proteins and signaling pathways, underscoring its importance in maintaining cellular homeostasis. Interestingly, mutations and alterations in BIN1 expression have been linked to conditions such as Alzheimer's disease, where it is believed to influence tau pathology and amyloid-beta metabolism. Moreover, studies indicate that BIN1 may also act as a tumor suppressor, highlighting its potential role in regulating cell proliferation and apoptosis in cancer. Given its multifunctional nature and the complexity of its interactions, the study of recombinant BIN1 proteins has become pivotal for elucidating its biological functions, therapeutic potential, and mechanisms underlying its involvement in disease. Understanding BIN1's structure-function relationship through recombinant protein studies not only provides insights into its physiological roles but also opens avenues for developing targeted interventions in related pathologies. The continuous exploration of BIN1 and its recombinant forms promises to shed light on its contributions to cellular integrity and the broader implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US