Analytical Data
-
Gene name
AURKB
- Application
-
Alternative Names
AURKB；AIK2；AIM1；AIRK2；Aurora kinase B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GD4
-
Expression Region
1-344aa
-
AA Sequence
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPT AAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH FIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRI YLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRD IKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMH NEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
-
Molecular Weight
68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Aurora B Kinase (AURKB) is a crucial serine/threonine kinase that plays a pivotal role in cell division, specifically during mitosis. It is a key component of the chromosomal passenger complex, which is essential for the proper alignment and segregation of chromosomes. Dysregulation of AURKB has been linked to various cancers, making it an attractive target for therapeutic intervention. Research into AURKB recombinant protein focuses on understanding its structural and functional properties, which are vital for elucidating its role in cell cycle regulation. Recombinant AURKB can be produced through recombinant DNA technology, enabling detailed biochemical and biophysical studies. These studies aim to investigate its enzymatic activity, substrate specificity, and interactions with other mitotic proteins. By constructing mutants and analyzing their effects on cellular function, researchers can uncover the mechanisms by which AURKB contributes to oncogenesis. Furthermore, recombinant AURKB is instrumental in drug screening efforts, where small molecules or peptides can be tested for their inhibitory effects on its kinase activity. This research is not only significant for basic cell biology but also provides insights into potential therapeutic strategies for targeting AURKB in cancer treatment. As such, the exploration of AURKB recombinant protein serves as a foundational aspect of ongoing studies aimed at developing novel anti-cancer therapies and improving our understanding of mitotic regulation.
