Analytical Data
-
Gene name
AUH
- Application
-
Alternative Names
AUH;Methylglutaconyl-CoA hydratase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13825
-
Expression Region
68-339aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSSEMKTEDELRVRHLEEENRGIVVLGINR AYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKER AKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDI RVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGK EAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQG MEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AUH (Aminohydrolase) is an essential enzyme involved in amino acid metabolism, particularly in the regulation of pyrimidine nucleotide synthesis and the detoxification of reactive metabolites. Recent studies have highlighted the enzyme's potential role in various biological processes, including DNA repair and cellular signaling pathways. Research into AUH recombination protein has gained momentum due to its implications in genetic disorders and diseases such as cancer, where dysregulation of amino acid metabolism is often observed. Understanding the mechanisms by which AUH functions at the molecular level could unveil new therapeutic targets for intervention. For instance, aberrant AUH activity has been linked to increased oxidative stress and cell proliferation, suggesting that modulating its expression or activity may help restore normal metabolic balance in affected tissues. Furthermore, the recent advancements in recombinant protein technology have facilitated the production of AUH in standardized forms, enabling detailed biochemical characterization and structural studies. These investigations aim to elucidate the enzyme's specific interactions with substrates and inhibitors, paving the way for the design of novel drugs. Overall, the research into AUH recombinant protein not only enhances our fundamental understanding of metabolic regulation but also opens new avenues for therapeutic strategies in treating metabolic disorders and improving cancer management.











