Analytical Data
-
Gene name
UCP2
- Application
-
Alternative Names
UCP2；SLC25A8；Dicarboxylate carrier SLC25A8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55851
-
Expression Region
1-309aa
-
AA Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLGTAKVRLQIQGESQGP VRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLY DSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARA GGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLI KDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQY SSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCP2, or uncoupling protein 2, is a member of the mitochondrial transporter family and plays a crucial role in energy metabolism and thermogenesis. Initially identified in brown adipose tissue, UCP2 is expressed in various tissues, including the brain, pancreas, and skeletal muscle, where it is involved in regulating oxidative stress and apoptosis. Research has shown that UCP2 acts as a proton channel in the inner mitochondrial membrane, facilitating uncoupling of oxidative phosphorylation, which leads to decreased ATP production and increased heat generation. This has significant implications for conditions like obesity, diabetes, and neurodegenerative diseases, as UCP2 dysregulation is associated with impaired metabolic functions and increased oxidative damage. Recombinant UCP2 protein studies aim to elucidate its biochemical properties, regulatory mechanisms, and interactions with other cellular components, thereby providing insights into its physiological roles. Furthermore, these studies may help identify potential therapeutic targets for metabolic disorders, advancing our understanding of mitochondrial dysfunction and its relation to various diseases. With ongoing research efforts, recombinant UCP2 protein has become a critical tool for investigating the protein's function and its potential applications in health and disease management.
