Analytical Data
-
Gene name
SEMA3B
- Application
-
Alternative Names
SEMA3B；SEMA5；SEMAA；；Semaphorin-3B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13214
-
Expression Region
651-748aa
-
AA Sequence
FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGG GGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATH
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEMA3B is a member of the semaphorin protein family, which plays crucial roles in various physiological processes, including neuronal development, angiogenesis, and immune response. Its function primarily involves guiding cell migration and promoting axonal growth inhibition, making it an important molecule in both developmental and pathological contexts. Research has shown that SEMA3B can act as a tumor suppressor in various cancers, as it influences tumor cell behavior and metastasis by inhibiting angiogenesis and modulating the immune response. The recombinant protein form of SEMA3B is often synthesized for in-depth studies to elucidate its mechanisms of action and potential therapeutic applications. By analyzing its interactions with receptors and downstream signaling pathways, researchers aim to gain insights into its role in cancer progression and other diseases. This research background highlights the importance of SEMA3B as a target for novel therapeutic strategies, particularly in cancer treatment, where enhancing its function may impede tumor growth and spread. Overall, studying recombinant SEMA3B offers valuable avenues for understanding its biological significance and exploring its potential in clinical applications.
