Cat: PA1000-8878

Recombinant Human FUT4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FUT4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FUT4;ELFT;FCT3A;Alpha-(1.3)-fucosyltransferase 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22083

  • Expression Region

    167-265aa

  • AA Sequence

    ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFN ISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FUT4, or fucosyltransferase 4, is an important enzyme that catalyzes the addition of fucose, a hexose sugar, to glycoproteins and glycolipids, playing a crucial role in cellular processes such as cell adhesion, immune response, and signaling. Its significance has garnered attention in various fields, including immunology, oncology, and developmental biology, as fucosylation can influence cell behavior and disease progression. Abnormal FUT4 expression has been associated with several pathological conditions, including cancer metastasis and inflammatory diseases. Understanding the mechanisms of FUT4 activity and regulation can potentially lead to novel therapeutic strategies targeting fucosylation-related pathways. Consequently, researchers are increasingly focused on producing recombinant FUT4 proteins to study their structure and function in detail. These recombinant proteins serve as valuable tools for elucidating the role of fucosylation in biological systems and for exploring their potential as biomarkers and therapeutic targets in disease contexts. Furthermore, advancements in recombinant DNA technology facilitate the efficient production of FUT4, allowing researchers to investigate its enzymatic mechanisms, substrate specificity, and interactions with other glycosylation enzymes, thereby paving the way for enhanced understanding of glycosylation's impact on human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US