Analytical Data
-
Gene name
YWHAZ
- Application
-
Alternative Names
YWHAZ；14-3-3 Protein zeta/delta
-
Species
Human
-
Source
E. coli
-
Tag
C-his
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31946
-
Expression Region
1-245aa
-
AA Sequence
AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
-
Molecular Weight
20.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YWHAZ, a member of the 14-3-3 protein family, plays a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis. Its ability to interact with numerous proteins and facilitate their phosphorylation status makes YWHAZ a central regulator in many signaling pathways. Research has shown that aberrations in YWHAZ expression levels are associated with several diseases, including cancers and neurodegenerative disorders. Due to its pivotal role in cell signaling, YWHAZ has emerged as a potential therapeutic target. Recent studies focused on the recombinant expression of YWHAZ proteins have aimed to elucidate its structure-function relationship and to understand its interactions with client proteins better. Utilizing techniques like recombinant DNA technology, researchers have successfully produced YWHAZ in various expression systems, allowing for the characterization of its biochemical properties. These efforts have significant implications for developing targeted therapeutic strategies and understanding the molecular mechanisms underlying its involvement in pathological conditions. Overall, the ongoing investigation into YWHAZ recombinant proteins aims to advance our comprehension of cellular regulation and its potential as a drug target in disease intervention.
