Analytical Data
-
Gene name
CBX5
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-10*His;C-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P45973
-
Expression Region
M1-S191
-
AA Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
-
Protein Length
Full Length
-
Molecular Weight
29.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CBX5, also known as heterochromatin protein 1, is a crucial component of the cellular machinery involved in maintaining genome integrity and regulating gene expression. As a part of the chromatin structure, CBX5 plays a significant role in the formation of heterochromatin, which is essential for the repression of transposable elements and the maintenance of genomic stability. The study of CBX5 has garnered considerable attention due to its implications in various biological processes, including aging, tumorigenesis, and response to stress. Abnormalities in its expression or function have been linked to several diseases, particularly cancers, where it may contribute to altered gene expression profiles. Recent research has focused on understanding the molecular mechanisms by which CBX5 exerts its effects on chromatin dynamics, gene regulation, and cellular differentiation. Additionally, the development of CBX5 recombinant proteins has opened up new avenues for exploring its functional properties and potential therapeutic applications, making it a key target in epigenetic research. Through investigations into CBX5, scientists aim to unravel the complexities of chromatin biology and its broader implications in health and disease, contributing to the advancement of targeted therapies and novel diagnostic approaches.
