Analytical Data
-
Gene name
B4GALT4
-
简介
B4GALT4 Protein, Human (HEK293, His) encodes a type II membrane protein with significant sequence similarity to other β1,4-galactosyltransferases. B4GALT4 mainly plays a role in glycolipid biosynthesis and has been recognized involving in cancer metastatic processes[1][2].
- Application
-
Alternative Names
rHuB4GALT4, His; Beta-1,4-Galactosyltransferase 4; Beta-1,4-GalTase 4; B4GALT4
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60513
-
Expression Region
Q39-A344
-
AA Sequence
QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAHHHHHH
-
Protein Length
Lumenal Domain
-
Molecular Weight
34-43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B4GALT4, or Beta-1,4-galactosyltransferase 4, is an important enzyme in the glycosylation process, specifically involved in synthesizing glycoproteins and glycolipids. This enzyme catalyzes the transfer of galactose to various acceptor sugars, playing a crucial role in modulating cellular interactions and signaling pathways. Mutations or malfunctions in the B4GALT4 gene have been linked to several diseases, including developmental disorders and certain neurological conditions. An increasing interest in understanding the structure and function of B4GALT4 arises from its potential impact on therapeutic applications, particularly in drug development and regenerative medicine. Additionally, the study of B4GALT4 and its recombinant protein form enables the exploration of its enzymatic activity and substrate specificity, thereby providing insights into its biological relevance. Research efforts focus on optimizing the expression and purification of the B4GALT4 recombinant protein, allowing for detailed biochemical characterization and functional assays. Understanding the mechanistic roles of B4GALT4 at a molecular level may lead to novel strategies for disease intervention and highlight its significance in the broader context of glycosylation-related disorders.
