Cat: PA2000-1022

Recombinant Human GSH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GSH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GSH;Glutathione synthetase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A6W9

  • Expression Region

    1-518aa

  • AA Sequence

    MIPDVSQALAWLEKHPQALKGIQRGLERETLRVNADGTLATTGHPEALGS ALTHKWITTDFAEALLEFITPVDGDIEHMLTFMRDLHRYTARNMGDERMW PLSMPCYIAEGQDIELAQYGTSNTGRFKTLYREGLKNRYGALMQTISGVH YNFSLPMAFWQAKCGDISGADAKEKISAGYFRVIRNYYRFGWVIPYLFGA SPAICSSFLQGKPTSLPFEKTECGMYYLPYATSLRLSDLGYTNKSQSNLG ITFNDLYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELY APIRPKRVTRSGESPSDALLRGGIEYIEVRSLDINPFSPIGVDEQQVRFL DLFMVWCALADAPEMSSSELACTRVNWNRVILEGRKPGLTLGIGCETAQF PLPQVGKDLFRDLKRVAQTLDSINGGEAYQKVCDELVACFDNPDLTFSAR ILRSMIDTGIGGTGKAFAEAYRNLLREEPLEILREEDFVAEREASERRQQ EMEAADTEPFAVWLEKHA

  • Molecular Weight

    74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Glutathione S-transferase (GST) is a significant family of enzymes involved in detoxification processes, playing a crucial role in cellular defense against oxidative stress and xenobiotic compounds. Recombinant GST proteins have gained increasing attention in biochemical and pharmaceutical research due to their versatile applications. The study of recombinant GSTs not only aids in understanding the mechanisms of drug metabolism and resistance but also facilitates the development of targeted therapies and diagnostic tools. Overexpression of GST genes in various expression systems allows for the production of large quantities of pure proteins, which can be utilized in enzymatic assays, structural studies, and as fusion tags for protein purification. The ability to manipulate GST through genetic engineering has led to the identification of novel enzyme variants with enhanced properties, expanding their applicability in biocatalysis and biotechnology. Furthermore, the exploration of GST structure-function relationships has elucidated critical insights into enzyme activity, thus paving the way for innovative strategies in drug design and therapeutic development. As research progresses, the comprehensive investigation of recombinant GST proteins continues to uncover their pivotal roles in biochemistry and medicine, highlighting their importance as tools not only for scientific advancement but also for clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US