Analytical Data
-
Gene name
PEG
- Application
-
Alternative Names
PEG；KIAA0287；ZSCAN24；Paternally-expressed gene 3 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09466
-
Expression Region
19-180aa
-
AA Sequence
MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
-
Molecular Weight
24.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PEGylated recombinant proteins have emerged as a significant advancement in biotechnology and therapeutic development, reflecting a convergence of protein engineering and polymer chemistry. The foundational concept behind PEGylation—the process of attaching polyethylene glycol (PEG) molecules to proteins—addresses several pivotal challenges in pharmaceutical protein therapies, including stability, solubility, and bioavailability. As recombinant proteins have gained prominence in treating various diseases, including cancers and genetic disorders, their innate properties often limit their clinical efficacy due to rapid clearance and immunogenicity. By modifying the surface characteristics of these proteins through PEGylation, researchers aim to prolong their circulation time in the bloodstream, enhance their therapeutic index, and reduce adverse immune reactions. This modification fosters a more favorable pharmacokinetic profile, leading to improved dosage regimens and patient compliance. The journey of PEGylated proteins has seen significant milestones, from initial proofs of concept to successful marketable drugs such as pegfilgrastim and peginterferon. Consequently, ongoing research continues to explore the optimal conditions for PEGylation, including the choice of PEG size and structure, as well as the specific attachment sites on the protein backbone, thereby tailoring their properties for diverse applications. Overall, PEGylated recombinant proteins represent a dynamic and evolving field, integrating multifaceted research efforts to revolutionize therapeutics and enhance patient care.
