Cat: IPD-X50110

Recombinant Human USP2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    USP2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    The fundamental role of USP2 is specific removal of ubiquitin from substrates. USP2 catalyses the ubiquitin from the substrate Ub-Rho110 to release fluorophores. Rho110 will release 535 nM emission light under the excitation condition of 485 nM. The signal of which can be quickly and reliably captured using a microplate reader.

  • Alternative Names

    USP2;UBP41;Ubiquitin carboxyl-terminal hydrolase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75604

  • Expression Region

    259-605aa

  • AA Sequence

    NSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGSNAHT ALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLL DGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKP TCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDL REFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMS SSQVRTSDAYLLFYELASPPSRM

  • Molecular Weight

    43.3kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

USP2 (Ubiquitin-specific protease 2) is a member of the deubiquitinating enzyme family, which plays a crucial role in the regulation of cellular processes by removing ubiquitin moieties from target proteins. Ubiquitination is a post-translational modification that typically marks proteins for degradation via the proteasome, thus controlling protein levels and signaling pathways in the cell. Research into USP2 has gained momentum due to its involvement in various biological functions, including cell cycle regulation, DNA repair, and apoptosis, as well as its implications in cancer biology. Studies have shown that USP2 can stabilize several oncoproteins, such as MDM2 and cyclin D1, leading to enhanced tumorigenesis. Additionally, USP2 has been implicated in the modulation of immune responses and the pathogenesis of neurodegenerative diseases. The enzymatic activity and substrate specificity of USP2 make it a potential target for therapeutic intervention, particularly in cancer treatment, where its inhibition could restore the degradation of aberrant proteins. As a result, understanding the biochemical properties and regulatory mechanisms of USP2 through studies involving its recombinant protein is essential. Researchers have focused on expressing and purifying USP2 recombinant protein to elucidate its functions, interactions, and structural characteristics, providing valuable insights that could lead to the development of novel therapeutic strategies targeting this enzyme in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US