Cat: IPD-X50107

Recombinant Human Cdk12 Protein,His&GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cdk12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cdk12;CRK7;CRKRS;KIAA0904;Cyclin-dependent kinase 12

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag ad GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NYV4

  • Expression Region

    727-1020aa

  • AA Sequence

    FDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQ LIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSED HIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEE SRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLEL AQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDL LDHMLTLDPSKRCTAEQTLQSDFL

  • Molecular Weight

    59.9kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cdk12, or Cyclin-dependent kinase 12, is a crucial regulator in the phosphorylation of RNA polymerase II, playing a significant role in transcriptional regulation and mRNA processing. Its dysregulation is associated with various cancers, particularly those characterized by chromosomal instability and alterations in DNA damage response. Research on Cdk12 has gained momentum due to its involvement in controlling gene expression via phosphorylation of serine 2 residues in the RNA polymerase II C-terminal domain, which is essential for the recruitment of splicing factors and polyadenylation machinery. Furthermore, mutations and copy number variations in the CDK12 gene have been implicated in tumorigenesis, highlighting its potential as a therapeutic target. The exploration of Cdk12 functions is imperative for understanding its contribution to cell cycle regulation, DNA repair mechanisms, and its broader impact on malignancies. Consequently, the study of Cdk12-recombinant proteins offers insights into the kinase's enzymatic properties and interaction with regulatory molecules, paving the way for the development of novel cancer therapies targeting Cdk12-associated pathways. Understanding the molecular mechanisms underlying Cdk12 activity not only enhances our comprehension of transcriptional dynamics in normal and cancerous cells but also extends the horizon for innovative treatment strategies aimed at rectifying the aberrant signaling pathways in tumors driven by Cdk12 alterations.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US