Cat: IPD-X50093

Recombinant Human FGL1 Protein,HEK293

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FGL1;HFREP1;Fibrinogen-like Protein 1

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q08830

  • Expression Region

    23-312aa

  • AA Sequence

    LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVI DLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTV IQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTL KIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPE VQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYS GPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

  • Molecular Weight

    60-65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FGL1 (Fibroblast Growth Factor-like 1) is a protein that plays a significant role in various biological processes, including immune regulation and tissue repair. Recent research has highlighted its potential involvement in cancer progression and immune evasion, making it a target of interest in cancer immunotherapy. FGL1 has been identified as a ligand for the immune checkpoint receptor LAG-3 (Lymphocyte Activation Gene-3), which is known to inhibit T cell activation and promote immune tolerance. Consequently, understanding the mechanisms of FGL1 and its interactions with LAG-3 can provide insights into tumor microenvironments and how tumors evade immune responses. Additionally, recombinant FGL1 proteins have been utilized in experimental settings to elucidate their functional roles in modulating immune cell activity. These studies suggest that manipulating FGL1 pathways could enhance anti-tumor immunity, offering new avenues for therapeutic intervention. Given the increasing prominence of immune checkpoint inhibitors in cancer therapy, further investigation into FGL1 and its recombinant forms is crucial for developing more effective treatment strategies that can potentially overcome immune resistance in various malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US