Analytical Data
-
Gene name
FMOD
- Application
-
Alternative Names
FMOD；FM；SLRR2E；Fibromodulin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06828
-
Expression Region
1-376aa
-
AA Sequence
MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI
-
Molecular Weight
43.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FMOD (Fibromodulin) is a small leucine-rich proteoglycan that plays a crucial role in the regulation of collagen assembly and maintenance of extracellular matrix integrity. Research on FMOD has gained attention due to its involvement in various biological processes, including tissue development, wound healing, and fibrotic diseases. Abnormal expression of FMOD is linked to conditions such as osteoarthritis, cancer, and other disorders, highlighting its potential as a therapeutic target. The study of recombinant FMOD protein allows researchers to explore its structural properties, functional mechanisms, and interactions with other matrix components. By producing FMOD in a recombinant form, scientists can investigate its role in modulating cell behavior, influencing matrix organization, and understanding its interactions with growth factors and cytokines in the extracellular environment. Furthermore, recombinant FMOD can be used in biotechnological applications for tissue engineering and regenerative medicine, where a better understanding of its functional roles could lead to significant advancements in therapeutic strategies for repairing damaged tissues and treating fibrotic conditions. Overall, the exploration of FMOD as a recombinant protein paves the way for deeper insights into its biological significance and potential clinical implications.
