Analytical Data
-
Gene name
ATG5
- Application
-
Alternative Names
ATG5；APG5L；ASP；Autophagy Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1Y0
-
Expression Region
1-275aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMTDDKDVLRDVWFGRIPTCFTLYQDEITER EAEPYYLLLPRVSYLTLVTDKVKKHFQKVMRQEDISEIWFEYEGTPLKWH YPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDAIEAHFMSCMK EADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPE DGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATG5, a vital autophagy-related protein, plays a crucial role in the cellular process of autophagy, which is essential for maintaining cellular homeostasis, degrading damaged organelles, and responding to stress. Autophagy is implicated in various physiological processes, including metabolism, immunity, and development, and is linked to the pathogenesis of numerous diseases such as neurodegeneration, cancer, and infections. ATG5 functions mainly in the formation of autophagosomes, and its activity is regulated by several signaling pathways. Research on recombinant ATG5 protein focuses on understanding the mechanistic details of autophagy and its regulation. By producing and studying recombinant ATG5, researchers aim to elucidate its interaction with other autophagy-related proteins and the downstream effects on cellular function. Furthermore, the investigation of ATG5's role in disease models may provide insights into therapeutic strategies, as modulation of autophagy represents a promising avenue for treating conditions associated with dysregulated autophagic processes. Given the intricate relationship between ATG5 and health, the study of this recombinant protein has gained attention in the fields of cell biology and biomedical research, highlighting its significant potential in developing innovative approaches for tackling various diseases.
