Cat: IPD-X50088

Recombinant Human CTNB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CTNB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    β-catenin

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35222

  • Expression Region

    439-675aa

  • AA Sequence

    CQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNL ALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTI PLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLS

  • Molecular Weight

    27.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

β-Catenin is a dual-function protein that plays a significant role in cell adhesion and the Wnt signaling pathway, making it a critical component in various biological processes such as development, cell differentiation, and tumorigenesis. Research on β-catenin has gained momentum due to its involvement in various cancers, particularly colorectal cancer, where mutations in the β-catenin gene lead to its aberrant accumulation and activation of Wnt target genes. Understanding the structure and function of β-catenin is essential for elucidating its complex regulatory mechanisms and interactions within the cellular environment. The production of recombinant β-catenin protein has emerged as a vital tool in studying its properties and biological roles. By utilizing techniques such as recombinant DNA technology, researchers can produce β-catenin in substantial quantities for in vitro studies, enabling detailed analyses of its molecular interactions, post-translational modifications, and signaling pathways. Furthermore, recombinant β-catenin can be crucial for the development of targeted therapies and biomolecular probes that aim to modulate its activity in disease contexts. Through these investigations, insights into the dynamics of β-catenin can pave the way for innovative therapeutic strategies and improve our understanding of cancers and developmental disorders associated with β-catenin dysregulation. Overall, the study of recombinant β-catenin protein is an essential endeavor in both basic and translational research, contributing to the broader field of molecular biology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US