Analytical Data
-
Gene name
BRMS1L
- Application
-
Alternative Names
BRMS1L；Breast cancer metastasis-suppressor 1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5PSV4
-
Expression Region
1-323aa
-
AA Sequence
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS
-
Molecular Weight
41.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRMS1L (Breast Cancer Metastasis Suppressor 1-Like) is a gene that encodes a protein involved in cellular processes that can influence cancer progression and metastasis. The research on BRMS1L emerged from its identification as a potential suppressor of breast cancer metastasis, which has directed scientists to investigate its role in various cancer types. Initial studies revealed that BRMS1L might interact with several signaling pathways and proteins implicated in tumor growth and metastasis. Understanding the functional mechanisms of BRMS1L can provide insights into cancer biology, particularly in how tumors disseminate from primary sites. Recent studies have focused on elucidating the molecular interactions of BRMS1L, its regulatory effects on gene expression, and its potential as a therapeutic target. The evolving research highlights BRMS1L's significance not only as a candidate biomarker for metastatic disease but also in devising novel cancer therapies aimed at inhibiting metastasis. This presents an exciting avenue for developing targeted interventions in oncology, underscoring BRMS1L's potential impact on improving patient outcomes in breast cancer and possibly other malignancies.
