Analytical Data
-
Gene name
GST
- Application
-
Alternative Names
MGST2;GST2;Microsomal glutathione S-transferase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43916
-
Expression Region
168-267aa
-
AA Sequence
PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLR ALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Glutathione S-transferases (GSTs) are a family of enzymes that play a crucial role in cellular detoxification by catalyzing the conjugation of glutathione to a variety of xenobiotics and endogenous compounds. They are essential for protecting cells from oxidative stress and are involved in various metabolic pathways. Research on GSTs has expanded due to their significance in pharmacology, toxicology, and cancer biology, as alterations in GST expression can influence drug metabolism and susceptibility to toxins. Additionally, certain GST isoforms have been implicated in the development of multidrug resistance in cancer cells, making them potential targets for therapeutic intervention. The study of GST proteins, especially through methods such as recombinant protein expression and purification, allows scientists to investigate their structure-function relationships, enzymatic mechanisms, and potential as biomarkers or drug targets. Recent trends in GST research also focus on their roles in signaling pathways, the interaction with other proteins, and their involvement in various diseases, including inflammation and neurodegeneration. This growing body of knowledge highlights the importance of GSTs in both basic and applied biomedical research, underscoring the need for continued investigation into their biochemical properties and therapeutic applications.
